Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Human (His)

TNC proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Human (His) is the recombinant human-derived TNC protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnc-protein-human-his.html

Purity

98.0

Smiles

DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Molecular Formula

3371 (Gene_ID) P24821-1 (D1888-A2201) (Accession)

Molecular Weight

Approximately 36-39.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAUREFROIDIE450X52RL-T1-LL-P16 Pipe Markers for Water
N001750 30 Pack (30 Marker (s) x 1 Roll)

EAUREFROIDIE450X52RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
SMARCB1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily b, Member 1, BAF47, INI1, RDT, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS)
251842 100 µg

SMARCB1 (SWI/SNF Related, Matrix Associated, Actin Dependent Regulator of chromatin, Subfamily b, Member 1, BAF47, INI1, RDT, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS)

Sign In for Pricing
View Details
ATP1A2 ORF Vector (Human) (pORF)
12673011 1.0 µg DNA

ATP1A2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Human RHOXF1 Protein
E30P2523 20 µg

Recombinant Human RHOXF1 Protein

Sign In for Pricing
View Details
Human CMV-IgG (cytomegalovirus-Immunoglobulin G) ELISA Kit
orb2938807-01 48 Tests

Human CMV-IgG (cytomegalovirus-Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Human CMV-IgG (cytomegalovirus-Immunoglobulin G) ELISA Kit
orb2938807-02 96 Tests

Human CMV-IgG (cytomegalovirus-Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details