Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G16, Human (His)

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine) . PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PLA2G16 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pla2g16-protein-human-his.html

Purity

95.00

Smiles

DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

Molecular Formula

11145 (Gene_ID) P53816 (D12-D132) (Accession)

Molecular Weight

14-17 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Mouse Shh (25-198, C25II) protein
CD00227-01 10 µg

Recombinant Mouse Shh (25-198, C25II) protein

Ask
View Details
Recombinant Mouse Shh (25-198, C25II) protein
CD00227-02 50 µg

Recombinant Mouse Shh (25-198, C25II) protein

Ask
View Details
KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K (+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (AP) discontinued
037320-AP 200 µL

KCNJ1, CT (KCNJ1, ROMK1, ATP-sensitive inward rectifier potassium channel 1, ATP-regulated potassium channel ROM-K, Inward rectifier K (+) channel Kir1.1, Potassium channel, inwardly rectifying subfamily J member 1) (AP) discontinued

Ask
View Details
Bovine N-acetylaspartate synthetase (NAT8L) ELISA Kit
NSL1443Bo 96 Tests

Bovine N-acetylaspartate synthetase (NAT8L) ELISA Kit

Ask
View Details
Cirhin (UTP4) Rabbit Polyclonal Antibody
TA365650 100 µL

Cirhin (UTP4) Rabbit Polyclonal Antibody

Ask
View Details