PLA2G16, Human (His)
The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine) . PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
PLA2G16 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pla2g16-protein-human-his.html
Purity
95.00
Smiles
DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Molecular Formula
11145 (Gene_ID) P53816 (D12-D132) (Accession)
Molecular Weight
14-17 kDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, HsHec1, Kinetochore-associated Protein 2, Retinoblastoma-associated Protein HEC, HEC, HEC1, KNTC2) (MaxLight 550)
NDC80 (Kinetochore Protein NDC80 Homolog, Highly Expressed in Cancer Protein, Kinetochore Protein Hec1, HsHec1, Kinetochore-associated Protein 2, Retinoblastoma-associated Protein HEC, HEC, HEC1, KNTC2) (MaxLight 550)
