Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Canine (HEK293, His)

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-canine-hek293-his.html

Purity

95.00

Smiles

NEGSVTGSCYCDKAISSGSPPTAELMAHLRKHLRVYQRCNSYVRFQLRMRSVCGGSKDPWVQQLMSCLDRKECGSADSRSVAPQEQLPPLSTQVPEPTERAPLDMGSPAQTYLPPAWRSTYLPTALQSTRQPVFPAGTLSLEKKLTHTSEIATSTVGHSLRTGSEAGESQKQQIKRVEPTAGTS

Molecular Formula

607514 (Gene_ID) XP_849304.2 (N22-S205) (Accession)

Molecular Weight

Approximately 30-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[2]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[3]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (FITC)
252074-FITC 100 µL

SPP1 (Secreted Phosphoprotein 1, BNSP, BSPI, ETA-1, MGC110940, OPN) (FITC)

Sign In for Pricing
View Details
KLHDC4 Protein Vector (Human) (pPM-C-HA)
PV022839 500 ng

KLHDC4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Stk16 (BC005703) Mouse Tagged ORF Clone
MR202684 10 µg

Stk16 (BC005703) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TSR2 AAV Vector (Human) (CMV)
48638101 1 µg

TSR2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
GALNT14 discontinued
509696 100 µg

GALNT14 discontinued

Sign In for Pricing
View Details
YWHAZ discontinued
396233-01 20 µL

YWHAZ discontinued

Sign In for Pricing
View Details