Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL16, Canine (HEK293, His)

CXCL16, also known as SR-PSOX (scavenger receptor that binds phosphatidylserine and oxidized lipoprotein), is one member of the ELR-negative CXC chemokine subfamily. CXCL16 is a multifunctional protein involved in various inflammatory diseases, atherosclerosis, and cancer. CXCL16 can be observed in many cell types[1][2]. CXCL16 Protein, Canine (HEK293, His) is produced in HEK293 cells with a C-Terminal His-tag. It consists of 205 amino acids (M1-S205) .

Product Specifications

Product Name Alternative

CXCL16 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl16-protein-canine-hek293-his.html

Purity

95.00

Smiles

NEGSVTGSCYCDKAISSGSPPTAELMAHLRKHLRVYQRCNSYVRFQLRMRSVCGGSKDPWVQQLMSCLDRKECGSADSRSVAPQEQLPPLSTQVPEPTERAPLDMGSPAQTYLPPAWRSTYLPTALQSTRQPVFPAGTLSLEKKLTHTSEIATSTVGHSLRTGSEAGESQKQQIKRVEPTAGTS

Molecular Formula

607514 (Gene_ID) XP_849304.2 (N22-S205) (Accession)

Molecular Weight

Approximately 30-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Tohyama M, et al. CXCL16 is a novel mediator of the innate immunity of epidermal keratinocytes. Int Immunol. 2007 Sep;19 (9) :1095-102.|[2]Jianhui Sun, et al. A Functional Variant of CXCL16 Is Associated With Predisposition to Sepsis and MODS in Trauma Patients: Genetic Association Studies. Front Genet. 2021 Sep 3;12:720313.|[3]Allaoui R, et al. Cancer-associated fibroblast-secreted CXCL16 attracts monocytes to promote stroma activation in triple-negative breast cancers. Nat Commun. 2016 Oct 11;7:13050.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BTBD10 Antibody (OTI7D3) [FITC]
NBP2-72293F 0.1 mL

Mouse Monoclonal BTBD10 Antibody (OTI7D3) [FITC]

Sign In for Pricing
View Details
Rat Tamm Horsfall Protein ELISA Kit
MBS729879-01 48 Well

Rat Tamm Horsfall Protein ELISA Kit

Sign In for Pricing
View Details
Rat Tamm Horsfall Protein ELISA Kit
MBS729879-02 96 Well

Rat Tamm Horsfall Protein ELISA Kit

Sign In for Pricing
View Details
Rat Tamm Horsfall Protein ELISA Kit
MBS729879-03 5x 96 Well

Rat Tamm Horsfall Protein ELISA Kit

Sign In for Pricing
View Details
Rat Tamm Horsfall Protein ELISA Kit
MBS729879-04 10x 96 Well

Rat Tamm Horsfall Protein ELISA Kit

Sign In for Pricing
View Details
HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 650)
MBS6222654-01 0.1 mL

HSPA1A (Heat Shock 70kD Protein 1A/1B, Heat Shock 70kD Protein 1/2, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSPA1, HSPA1B) (MaxLight 650)

Sign In for Pricing
View Details