Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293, Fc)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293, Fc) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293-fc.html

Purity

95.00

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (T31-P204) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL
BNC400669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details