Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G-CSF, Human (HEK293, Fc)

G-CSF, a pivotal cytokine, regulates hematopoiesis by controlling the production, differentiation, and function of granulocytes and monocytes-macrophages. This monomeric protein specifically promotes granulocyte development, playing a crucial role in immune system regulation and blood cell formation. G-CSF Protein, Human (HEK293, Fc) is the recombinant human-derived G-CSF protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

G-CSF Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/g-csf-protein-human-hek293-fc.html

Purity

95.00

Smiles

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Molecular Formula

1440 (Gene_ID) P09919-2/NP_757373.1 (T31-P204) (Accession)

Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppl 3'UTR GFP Stable Cell Line
TU166785 1.0 mL

Ppl 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cyp3a57 3'UTR Lenti-reporter-Luc Vector
17456084 1.0 µg

Cyp3a57 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit
MBS085593-01 48 Well

Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit
MBS085593-02 96 Well

Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit
MBS085593-03 5x 96 Well

Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit
MBS085593-04 10x 96 Well

Sheep Chemokine C-C-Motif Receptor 6 ELISA Kit

Sign In for Pricing
View Details