Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS1/EWSR2, Human (His)

ETS1/EWSR2 Protein, a transcription factor, directly regulates cytokine and chemokine gene expression in diverse cellular contexts. It controls lymphoid cell differentiation, survival, and proliferation, possibly impacting angiogenesis by regulating genes controlling endothelial cell migration and invasion. Additionally, it acts as a dominant-negative for isoform c-ETS-1A. ETS1/EWSR2 Protein, Human (His) is the recombinant human-derived ETS1/EWSR2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ETS1/EWSR2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ets1-ewsr2-protein-human-his.html

Purity

97.00

Smiles

MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

Molecular Formula

2113 (Gene_ID) P14921-5 (M1-T272) (Accession)

Molecular Weight

Approximately 36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSS1 HDR Plasmid (m)
sc-427162-HDR 20 µg

ACSS1 HDR Plasmid (m)

Sign In for Pricing
View Details
Mycophenolic acid-O-beta-D-glucuronide
BICL4131-01 1 mg

Mycophenolic acid-O-beta-D-glucuronide

Sign In for Pricing
View Details
Mycophenolic acid-O-beta-D-glucuronide
BICL4131-02 2 mg

Mycophenolic acid-O-beta-D-glucuronide

Sign In for Pricing
View Details
Mycophenolic acid-O-beta-D-glucuronide
BICL4131-03 5 mg

Mycophenolic acid-O-beta-D-glucuronide

Sign In for Pricing
View Details
Human Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) ELISA Kit
BSKH63677-01 48 Tests

Human Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) ELISA Kit

Sign In for Pricing
View Details
Human Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) ELISA Kit
BSKH63677-02 96 Tests

Human Heparan Sulfate-6-O-Sulfotransferase 3 (HS6ST3) ELISA Kit

Sign In for Pricing
View Details