Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 delta/REG3D, Mouse (HEK293, His)

REG3D Protein enables protein binding activity and is is involved in response to peptide hormone. REG-3 delta/REG3D Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 delta/REG3D protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

REG-3 delta/REG3D Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3d-protein-mouse-hek293-his.html

Purity

95.0

Smiles

EQSQKKLSSPRISCPQEAQAYGSYCYLLILEPQTWANAEIHCQKHFSGHLAFLLTYGEIIFVSSLVKNSLTTFPYIWIGLHDLSLGSLPNENGWKWSSSDPLTFYNWEIPPSMSAHHGYCAALSQASGYQKWRDYYCDTIFPYVCKFKG

Molecular Formula

30053 (Gene_ID) Q9QUS9/NP_038921.2 (E27-G175) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNK1 CRISPR/Cas9 KO Plasmid (h)
sc-403355 20 µg

CNK1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
TP53I11 Antibody : Biotin (OAAF02001-Biotin)
OAAF02001-100UG-Biotin 100 µg

TP53I11 Antibody : Biotin (OAAF02001-Biotin)

Sign In for Pricing
View Details
NME2 Adenovirus (Mouse)
31944055 1.0 mL

NME2 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Atp13a3 activation kit by CRISPRa
GA213670 1 Kit

Mouse Atp13a3 activation kit by CRISPRa

Sign In for Pricing
View Details
COX19 Antibody
A53165-100UL 100 µL

COX19 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein yahC (yahC)
MBS1004337 Inquire

Recombinant Escherichia coli Uncharacterized protein yahC (yahC)

Sign In for Pricing
View Details