Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CORO1B activation kit by CRISPRa
GA111426 1 Kit

Human CORO1B activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS805538 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
LINC01205 (NM_001145553) Human Over-expression Lysate
LC428941 20 µg

LINC01205 (NM_001145553) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Ewsr1 activation kit by CRISPRa
GA201321 1 Kit

Mouse Ewsr1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Nose
CS503483 5x 5 µm

Frozen Tissue Sections, Nose

Sign In for Pricing
View Details
Edf1 (NM_021519) Mouse Tagged ORF Clone
MG201022 10 µg

Edf1 (NM_021519) Mouse Tagged ORF Clone

Sign In for Pricing
View Details