Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A20 Human Gene Knockout Kit (CRISPR)
KN400234 1 Kit

SLC25A20 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]
CL116FX 500 µg

Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]

Sign In for Pricing
View Details
Cathepsin L Recombinant Rabbit monoclonal Antibody
HA750916 100 µL

Cathepsin L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SIAH1 Human Gene Knockout Kit (CRISPR)
KN206576BN 1 Kit

SIAH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS500373 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice
P014-405M-500 1x 500 µL

CD81 Recombinant Monoclonal Mouse Antibody (2304.81), CF®405M Conjugate - Biotium Choice

Sign In for Pricing
View Details