Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOB2 Rabbit Polyclonal Antibody
TA382693 100 µL

TOB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3,3',5-Trichlorobisphenol A
TRC-T774100-1MG 1 mg

3,3',5-Trichlorobisphenol A

Sign In for Pricing
View Details
Cyclin G (CCNG1) Rabbit Polyclonal Antibody
TA374387 100 µL

Cyclin G (CCNG1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Neuregulin 2 (NRG2) ELISA Kit
RD-NRG2-Ra-01 96 Tests

Rat Neuregulin 2 (NRG2) ELISA Kit

Sign In for Pricing
View Details
Rat Neuregulin 2 (NRG2) ELISA Kit
RD-NRG2-Ra-02 48 Tests

Rat Neuregulin 2 (NRG2) ELISA Kit

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
E-EL-H6279-01 24 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details