Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEX5 (NM_001012978) Human Over-expression Lysate
LY422940 100 µg

BEX5 (NM_001012978) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Tryptophanyl tRNA synthetase (WARS) activation kit by CRISPRa
GA105135 1 Kit

Human Tryptophanyl tRNA synthetase (WARS) activation kit by CRISPRa

Sign In for Pricing
View Details
XPA (C-term) Rabbit Polyclonal Antibody
AP18245PU-N 400 µL

XPA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF837 (NM_138466) Human Over-expression Lysate
LY430049 100 µg

ZNF837 (NM_138466) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CD11b (ITGAM) activation kit by CRISPRa
GA102474 1 Kit

Human CD11b (ITGAM) activation kit by CRISPRa

Sign In for Pricing
View Details
Prlr Mouse Gene Knockout Kit (CRISPR)
KN313929 1 Kit

Prlr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details