Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDP-35/TDP-43 Antibody
KC-8430-01 50 μL

TDP-35/TDP-43 Antibody

Sign In for Pricing
View Details
TDP-35/TDP-43 Antibody
KC-8430-02 100 µL

TDP-35/TDP-43 Antibody

Sign In for Pricing
View Details
TDP-35/TDP-43 Antibody
KC-8430-03 1 mL

TDP-35/TDP-43 Antibody

Sign In for Pricing
View Details
IFluor® 647 TCO
1011-AAT 1 mg

IFluor® 647 TCO

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), CF647 conjugate, 0.1mg/mL
BNC471947-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCOA2 Mouse Monoclonal Antibody [Clone ID: OTI3C7]
CF805126 100 µg

NCOA2 Mouse Monoclonal Antibody [Clone ID: OTI3C7]

Sign In for Pricing
View Details