Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIF, Human (HEK293)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (HEK293) is the recombinant human-derived LIF protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

LIF Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lif-protein-human-hek293.html

Purity

97.70

Smiles

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Formula

3976 (Gene_ID) P15018-1 (S23-F202) (Accession)

Molecular Weight

Approximately 24-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDH1 Protein Vector (Human) (pPB-His-MBP)
PV326702 500 ng

BDH1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Lentiviral human HSPBAP1 shRNA (UAS) - Lentiviral human HSPBAP1 shRNA (UAS, iRFP) (25)
GTR15108866 1 Vial

Lentiviral human HSPBAP1 shRNA (UAS) - Lentiviral human HSPBAP1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TSPAN1, ID (TSPAN1, Tetraspanin-1, Tetraspan NET-1, Tetraspanin TM4-C) (MaxLight 490) discontinued
043372-ML490 100 µL

TSPAN1, ID (TSPAN1, Tetraspanin-1, Tetraspan NET-1, Tetraspanin TM4-C) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ABTB1 Antibody
A11645-100UL 100 µL

ABTB1 Antibody

Sign In for Pricing
View Details
DKK4 (NM_014420) Human Over-expression Lysate
LC402331 20 µg

DKK4 (NM_014420) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP8B2 Blocking Peptide
33R-4690 100 ug

ATP8B2 Blocking Peptide

Sign In for Pricing
View Details