Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTACK/CCL27, Human

CTACK/CCL27 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR10, attracts skin-associated memory T lymphocytes, mediates lymphocyte homing to skin sites, and plays a key role in skin inflammation. CTACK/CCL27 Protein, Human a recombinant human CTACK/CCL27 (F25-G112) protein expressed by E. coli[1][2].

Product Specifications

Product Name Alternative

CTACK/CCL27 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl27-protein-human.html

Purity

95.0

Smiles

FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Molecular Formula

10850 (Gene_ID) Q9Y4X3 (F25-G112) (Accession)

Molecular Weight

Approximately 14 kDa

References & Citations

[1]Jette Lindorff Riis, et al. CCL27 expression is regulated by both p38 MAPK and IKKβ signalling pathways. Cytokine. 2011 Dec;56 (3) :699-707.|[2]Lin Chen, et al. CCL27 is a critical factor for the development of atopic dermatitis in the keratin-14 IL-4 transgenic mouse model. Int Immunol. 2006 Aug;18 (8) :1233-42.|[3]Bernhard Homey, et al. CCL27-CCR10 interactions regulate T cell-mediated skin inflammation. Nat Med. 2002 Feb;8 (2) :157-65.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROTAC BRAF-V600E degrader-1
T8745-01 1 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details
PROTAC BRAF-V600E degrader-1
T8745-02 5 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details
PROTAC BRAF-V600E degrader-1
T8745-03 10 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details
PROTAC BRAF-V600E degrader-1
T8745-04 25 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details
PROTAC BRAF-V600E degrader-1
T8745-05 50 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details
PROTAC BRAF-V600E degrader-1
T8745-06 100 mg

PROTAC BRAF-V600E degrader-1

Sign In for Pricing
View Details