Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat α-L-iduronidase (IDUA) ELISA Kit
EIA05116r 1 Kit

Rat α-L-iduronidase (IDUA) ELISA Kit

Sign In for Pricing
View Details
AMC-04
HY-28325 1 Each

AMC-04

Sign In for Pricing
View Details
Guanine nucleotide-binding protein-Like 1 (GNL1) Mouse ELISA Kit
D9095 96 Tests

Guanine nucleotide-binding protein-Like 1 (GNL1) Mouse ELISA Kit

Sign In for Pricing
View Details
Human CEACAM-5 Protein, Llama IgG2b Fc Tag, low endotoxin (MALS verified)
CE5-H5259-100ug 100 µg

Human CEACAM-5 Protein, Llama IgG2b Fc Tag, low endotoxin (MALS verified)

Sign In for Pricing
View Details
Notch 2 (Cleaved-Asp1733) Antibody
MBS855201-01 0.1 mg

Notch 2 (Cleaved-Asp1733) Antibody

Sign In for Pricing
View Details
Notch 2 (Cleaved-Asp1733) Antibody
MBS855201-02 0.1 mL (AF635)

Notch 2 (Cleaved-Asp1733) Antibody

Sign In for Pricing
View Details