Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Reg3A Antibody (010) [Alexa Fluor 647]
NBP2-90468AF647 0.1 mL

Rabbit Monoclonal Reg3A Antibody (010) [Alexa Fluor 647]

Sign In for Pricing
View Details
PPP2R1B Protein Vector (Mouse) (pPM-C-His)
PV218665 500 ng

PPP2R1B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MMACHC
pro-1119 5µg

MMACHC

Sign In for Pricing
View Details
Rat Liver Sinusoidal Endothelial Cells
ABC-TC4154 1 Vial

Rat Liver Sinusoidal Endothelial Cells

Sign In for Pricing
View Details
Tubb5 (NM_173102) Rat Tagged Lenti ORF Clone
RR205138L3 10 µg

Tubb5 (NM_173102) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat TRDMT1 shRNA Plasmid
abx988497-01 150 µg

Rat TRDMT1 shRNA Plasmid

Sign In for Pricing
View Details