Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX27 Rabbit Polyclonal Antibody
TA309874 100 µL

SNX27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human AIF1L shRNA (UAS) - Lentiviral human AIF1L shRNA (UAS, RFP) (100)
GTR15326163 1 Vial

Lentiviral human AIF1L shRNA (UAS) - Lentiviral human AIF1L shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RAB30 (NM_014488) Human Recombinant Protein
TP304318M 100 µg

RAB30 (NM_014488) Human Recombinant Protein

Sign In for Pricing
View Details
Human SSR1 knockout cell line
ABC-KH14705 1 Vial

Human SSR1 knockout cell line

Sign In for Pricing
View Details
GW843682X 1mg
A11438-1 1 mg

GW843682X 1mg

Sign In for Pricing
View Details
TSTD3 (NM_001195131) Human Over-expression Lysate
LS100130890-20ug 20 µg

TSTD3 (NM_001195131) Human Over-expression Lysate

Sign In for Pricing
View Details