Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBVM1 3'UTR Luciferase Stable Cell Line
TU006528 1.0 mL

EBVM1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human B3GAT1
P1529-01 50 µg

Recombinant Human B3GAT1

Sign In for Pricing
View Details
Recombinant Human B3GAT1
P1529-02 200 µg

Recombinant Human B3GAT1

Sign In for Pricing
View Details
Recombinant Human B3GAT1
P1529-03 1 mg

Recombinant Human B3GAT1

Sign In for Pricing
View Details
Anti Naegleria Gruberi Pab
272662 100 µg

Anti Naegleria Gruberi Pab

Sign In for Pricing
View Details
Pdik1l sgRNA CRISPR Lentivector (Rat) (Target 2)
K6667203 1.0 µg DNA

Pdik1l sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details