Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX16, Cytochrome C Oxidase Assembly Homolog (COX16) Antibody
abx213603-01 50 µL

COX16, Cytochrome C Oxidase Assembly Homolog (COX16) Antibody

Sign In for Pricing
View Details
COX16, Cytochrome C Oxidase Assembly Homolog (COX16) Antibody
abx213603-02 100 µL

COX16, Cytochrome C Oxidase Assembly Homolog (COX16) Antibody

Sign In for Pricing
View Details
AE Binding Protein 1/ACLP Recombinant Protein Antigen
NBP2-55784PEP 100 µL

AE Binding Protein 1/ACLP Recombinant Protein Antigen

Sign In for Pricing
View Details
LYRM4 Antibody, HRP conjugated
A68899-50UG 50 µg

LYRM4 Antibody, HRP conjugated

Sign In for Pricing
View Details
INSM2 Conjugated Antibody
MBS9455506-01 0.1 mL (Biotin)

INSM2 Conjugated Antibody

Sign In for Pricing
View Details
INSM2 Conjugated Antibody
MBS9455506-02 0.1 mL (AF350)

INSM2 Conjugated Antibody

Sign In for Pricing
View Details