IL-13, Cynomolgus (HEK293)
IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html
Purity
97.60
Smiles
SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN
Molecular Formula
102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)
Molecular Weight
Approximately 12.3 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Calcineurin (Serine/Threonine Protein Phosphatase 2B Catalytic Subunit, alpha Isoform, Calmodulin-dependent Calcineurin A Subunit, alpha Isoform, CAM-PRP Catalytic Subunit, PPP3CA, CALNA, CNA) (MaxLight 650)
YV012, CT (Leucine-rich repeat-containing protein LOC400891) (AP)
YV012, CT (Leucine-rich repeat-containing protein LOC400891) (AP)
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 6, Ileal (FABP6)
