Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Cynomolgus (HEK293)

IL-13 Protein, a pivotal cytokine, plays crucial roles in allergic inflammation and immune responses to parasites. Synergizing with IL2, it regulates interferon-gamma synthesis, stimulates B-cell proliferation, and activates eosinophils, basophils, and mast cells. IL-13 controls IL33 activity, modulating IL1RL1 production. It antagonizes Th1-driven responses, suppressing NF-kappa-B and downregulating proinflammatory cytokines. IL-13 effects are mediated through IL4R and IL13RA1, activating JAK1, TYK2, and STAT6. IL-13 Protein, Cynomolgus (HEK293) is the recombinant cynomolgus-derived IL-13 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IL-13 Protein, Cynomolgus (HEK293), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-cynomolgus-hek293.html

Purity

97.60

Smiles

SPVPPSTALKELIEELVNITQNQKAPLCNGSMVWSINLTAGVYCAALESLINVSGCSAIEKTQRMLNGFCPHKVSAGQFSSLRVRDTKIEVAQFVKDLLVHLKKLFREGQFN

Molecular Formula

102125887 (Gene_ID) ABG75889.1 (S21-N132) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp12-set siRNA/shRNA/RNAi Lentivector (Rat)
49276096 4x 500 ng

Usp12-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
ANKRD42 3'UTR GFP Stable Cell Line
TU050828 1.0 mL

ANKRD42 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
IgA, alpha discontinued
I1890-05N 1 mg

IgA, alpha discontinued

Sign In for Pricing
View Details
Th-Pok Antibody / ZBTB7B
V9232SAF-100UG 100 µg

Th-Pok Antibody / ZBTB7B

Sign In for Pricing
View Details
Recombinant Human SERPINA12 Protein, N-GST
YHK05701 100 μg

Recombinant Human SERPINA12 Protein, N-GST

Sign In for Pricing
View Details
OLAH Antibody / Oleoyl-ACP hydrolase
RQ7895 100 µg

OLAH Antibody / Oleoyl-ACP hydrolase

Sign In for Pricing
View Details