Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anti-MFF Antibody FL650 Conjugate

Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by Protein A chromatography. It is great for use in IHC, ICC.

Product Specifications

Background

Mitochondrial fission factor, also known as Mff, is a tail-anchored, outer mitochondrial membrane protein that is part of a complex process controlling mitochondrial and peroxisomal fission in conjunction with Drp1 and Fis1 (Schrader and Yoon, 2007) . The rate of mitochondrial fission and fusion balance each other for cell growth and survival of mitochondria. Fission can be greatly accelerated when cytochrome c is released during apoptosis (Desagher and Martinou, 2000) . Mff was identified as an important component of the process through siRNA transfected cells, isolating the protein in the P2 pellet and demonstrating that Mff is exposed to the cytosol (Gandre-Babbe and van der Bliek 2008) . Mff has been identified at different stages of the fission process working alongside, rather than in complex with, Fis1 suggesting that Mff contributes to fission independent of the Fis1 complex (Gandre-Babbe and van der Bliek 2008) .

Short Description

Our Anti-MFF mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N382/14. It is KO validated, detects human, mouse, and rat MFF, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Synonyms

Mitochondrial fission factor

Gene Name

MFF C2orf33 AD030 AD033 GL004

UniProt

Q9GZY8

Host

Mouse

Reactivity

Human, Mouse, and Rat

Immunogen

Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGIS QRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQS TPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQL VRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDM TVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and most of 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030, AD033 and GL004, accession number Q9GZY8) ; Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical) ; Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical) ; Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical)

Target

MFF

Clonality

Monoclonal

Isotype

IgG1

Clone

N382/14

Type

Primary Antibody

Applications

IHC, ICC

Field of Research

Mitochondrial Biology

Concentration

0.5 mg/mL

Format

Purified by Protein A chromatography

Buffer

PBS with 0.09% azide

Molecular Weight

40 kDa

Shipping Conditions

Shipped on ice packs

Storage Conditions

Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Notes

Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Specificity

No cross-reactivity reported

Quality Control

Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.

Recommended Usage

These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.

Physical Properties

Liquid

Immunogen Species

Human

WB Brain Quality Control

1

Conjugate

FL650 Ex: 655 nm, Em: 676 nm

RRID

AB_2940231

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCAP Antibody
KC-1623-01 50 μL

TCAP Antibody

Sign In for Pricing
View Details
TCAP Antibody
KC-1623-02 100 µL

TCAP Antibody

Sign In for Pricing
View Details
TCAP Antibody
KC-1623-03 1 mL

TCAP Antibody

Sign In for Pricing
View Details
Human OR51Q1 activation kit by CRISPRa
GA118100 1 Kit

Human OR51Q1 activation kit by CRISPRa

Sign In for Pricing
View Details
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF594 conjugate, 0.1mg/mL
BNC941801-100 1x 100 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCL1 Polyclonal Antibody
E-AB-60044-01 60 µL

MCL1 Polyclonal Antibody

Sign In for Pricing
View Details