Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Anoctamin-5 (ANO5), partial

Product Specifications

Product Name Alternative

(Gnathodiaphyseal dysplasia 1 protein) (Transmembrane protein 16E)

Abbreviation

Recombinant Human ANO5 protein, partial

Gene Name

ANO5

UniProt

Q75V66

Expression Region

1-299aa

Organism

Homo sapiens (Human)

Target Sequence

MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLMFQKNQQSKDSIFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDKRDSEDGRTYFVKIHAPWEVLVTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVKYPHPEYFTAQFSRHRQELFLIEDQATFFPSSSRNRIVYYILSRCPFGIEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Does not exhibit calcium-activated chloride channel (CaCC) activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.9 kDa

References & Citations

"ANO5 gene analysis in a large cohort of patients with anoctaminopathy: confirmation of male prevalence and high occurrence of the common exon 5 gene mutation." Sarkozy A., Hicks D., Hudson J., Laval S.H., Barresi R., Hilton-Jones D., Deschauer M., Harris E., Rufibach L., Hwang E., Bashir R., Walter M.C., Krause S., van den Bergh P., Illa I., Penisson-Besnier I., De Waele L., Turnbull D. Lochmuller H. Hum Mutat 34:1111-1118 (2013) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il2ra Rat Monoclonal Antibody [Clone ID: PC61.5.3]
AM26037LE-M 500 µg

Il2ra Rat Monoclonal Antibody [Clone ID: PC61.5.3]

Sign In for Pricing
View Details
FH Antibody
KC-1939-01 50 μL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-1939-02 100 µL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-1939-03 1 mL

FH Antibody

Sign In for Pricing
View Details
PAGE4 (NM_007003) Human Recombinant Protein
TP761394 50 µg

PAGE4 (NM_007003) Human Recombinant Protein

Sign In for Pricing
View Details
FITC Anti-Mouse TCR γ/δ Antibody[GL3]
E-AB-F1282C-01 50 Tests

FITC Anti-Mouse TCR γ/δ Antibody[GL3]

Sign In for Pricing
View Details