Anti-REEP1 Antibody FL550 Conjugate

Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008

Our Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli

Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.