TIM-14, S.cerevisiae
The TIM-14 protein is an important component of the PAM complex and is required for the transport of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix using ATP. TIM-14 Protein, S.cerevisiae is the recombinant TIM-14 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TIM-14 Protein, S.cerevisiae, Others, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tim14-protein-s-cerevisiae.html
Smiles
FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Molecular Formula
850694 (Gene_ID) Q07914 (F99-K168) (Accession)
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Mouse U3 small nucleolar ribonucleoprotein protein IMP4 (IMP4) ELISA Kit
SERPINA9, ID (SERPINA9, GCET1, SERPINA11, Serpin A9, Centerin, Germinal center B Cell-expressed transcript 1 protein) (MaxLight 490) discontinued