Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZG16B, Human (HEK293, His)

Zymogen granule protein 16 homolog B is a secretory lectin protein that is a highly expressed gene in human salivary gland tissue. Zymogen granule protein 16 homolog B shares sequence homology with its paralog, ZG16p, containing a NH2-terminal signal sequence, putative related lectin domains, and an N-linked glycosylation site. ZG16B Protein, Human (HEK293, His) is the recombinant human-derived ZG16B protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

ZG16B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zg16b-protein-human-hek293-his.html

Purity

97.00

Smiles

GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Molecular Formula

124220 (Gene_ID) Q96DA0 (G17-R172) (Accession)

Molecular Weight

Approximately 24-27 kDa

References & Citations

[1]Escudero-Paniagua B, et al. PAUF/ZG16B promotes colorectal cancer progression through alterations of the mitotic functions and the Wnt/β-catenin pathway. Carcinogenesis. 2020 Apr 22;41 (2) :203-213.|[2]Ghosh S, et al. Human oral lectin ZG16B acts as a cell wall polysaccharide probe to decode host-microbe interactions with oral commensals. Proc Natl Acad Sci U S A. 2023 May 30;120 (22) :e2216304120.|[3]Yoo W, et al. Pancreatic cancer induces muscle wasting by promoting the release of pancreatic adenocarcinoma upregulated factor. Exp Mol Med. 2021 Mar;53 (3) :432-445.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)
abx344899-01 20 µg

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)
abx344899-02 50 µg

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)
abx344899-03 100 µg

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)
abx344899-04 200 µg

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)

Sign In for Pricing
View Details
Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)
abx344899-05 1 mg

Zinc Finger Protein 37A (ZNF37A) Antibody (FITC)

Sign In for Pricing
View Details
Human GPR89A activation kit by CRISPRa
GA118849 1 Kit

Human GPR89A activation kit by CRISPRa

Sign In for Pricing
View Details