What is the catalog number for IL-10, Human?

The catalog number for IL-10, Human is HY-P7030.

What sizes are available for IL-10, Human?

IL-10, Human is available in the following size(s): 2 µg, 10 µg, 20 µg, 50 µg, 100 µg.

How many pack sizes does IL-10, Human come in?

IL-10, Human is available in 5 different pack sizes.

Is IL-10, Human in stock?

IL-10, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures IL-10, Human?

IL-10, Human is manufactured by QuantiMol.

What is the estimated delivery time for IL-10, Human?

Estimated delivery time for IL-10, Human is approximately 15 business day(s), depending on your location.

IL-10, Human

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human.html

Purity

97.60

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301/NP_000563.1 (S19-N178) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.