Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Human

IL-10 Protein, Human is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Product Specifications

Product Name Alternative

IL-10 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-human.html

Purity

97.60

Smiles

SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Molecular Formula

3586 (Gene_ID) P22301/NP_000563.1 (S19-N178) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119 (6) :1473-82.|[2]Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91 (5) :1334-42.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Leukocyte Antigen A ELISA Kit
MBS017037-01 48 Well

Sheep Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Sheep Leukocyte Antigen A ELISA Kit
MBS017037-02 96 Well

Sheep Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Sheep Leukocyte Antigen A ELISA Kit
MBS017037-03 5x 96 Well

Sheep Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Sheep Leukocyte Antigen A ELISA Kit
MBS017037-04 10x 96 Well

Sheep Leukocyte Antigen A ELISA Kit

Sign In for Pricing
View Details
Syntaxin 1A Antibody
E51A02331 100 µL

Syntaxin 1A Antibody

Sign In for Pricing
View Details
DEGS1 (NM_144780) Human Over-expression Lysate
LH14152V 100 µg

DEGS1 (NM_144780) Human Over-expression Lysate

Sign In for Pricing
View Details