Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thy1/CD90, Rat (HEK293, His)

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Thy1/CD90 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/thy1-cd90-protein-rat-hek293-his.html

Purity

98.0

Smiles

QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVK

Molecular Formula

24832 (Gene_ID) P01830 (Q20-K129) (Accession)

Molecular Weight

Approximately 23-27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CASPR2/CNTNAP2 Antibody (R2N62)
RHN21704 100 μg

Anti-CASPR2/CNTNAP2 Antibody (R2N62)

Sign In for Pricing
View Details
Human Major Histocompatibility Complex Class I A (MHCA) ELISA Kit
EKN46881 96 Tests

Human Major Histocompatibility Complex Class I A (MHCA) ELISA Kit

Sign In for Pricing
View Details
Progestin Receptor Beta (PAQR8) (NM_133367) Human Over-expression Lysate
E45H13640-2 20 µg

Progestin Receptor Beta (PAQR8) (NM_133367) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-cGKI (Thr515) Rabbit pAb
E47R7368 100 µL

Phospho-cGKI (Thr515) Rabbit pAb

Sign In for Pricing
View Details
Human Adenosine A1 Receptor ELISA Kit
MBS062289-01 48 Well

Human Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details
Human Adenosine A1 Receptor ELISA Kit
MBS062289-02 96 Well

Human Adenosine A1 Receptor ELISA Kit

Sign In for Pricing
View Details