Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane A/OmpA, E.coli (His-SUMO)

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

Outer membrane protein A/OmpA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-protein-a-ompa-protein-e-coli-his-sumo.html

Purity

97.00

Smiles

WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Molecular Formula

917123 (Gene_ID) P0A911 (W164-A346) (Accession)

Molecular Weight

Approximately 35.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MANF/ARMET Protein (Fc Tag)
PKSH030537 100 µg

Recombinant Human MANF/ARMET Protein (Fc Tag)

Sign In for Pricing
View Details
Human OR1D4 activation kit by CRISPRa
GA118827 1 Kit

Human OR1D4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-01 50 μL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-02 100 µL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-03 1 mL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details
Hoechst 33342 azide
17674-AAT 1 mg

Hoechst 33342 azide

Sign In for Pricing
View Details