Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Outer membrane A/OmpA, E.coli (His-SUMO)

Outer membrane protein A (OmpA) ensures the structural integrity of the bacterial cell wall and cooperates with TolR to stabilize the peptidoglycan layer. As a porin, OmpA controls the permeability of small solutes. Outer membrane protein A/OmpA Protein, E.coli (His-SUMO) is the recombinant E. coli-derived Outer membrane protein A/OmpA protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

Outer membrane protein A/OmpA Protein, E.coli (His-SUMO), E.coli, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/outer-membrane-protein-a-ompa-protein-e-coli-his-sumo.html

Purity

97.00

Smiles

WTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA

Molecular Formula

917123 (Gene_ID) P0A911 (W164-A346) (Accession)

Molecular Weight

Approximately 35.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP17-1 3'UTR GFP Stable Cell Line
TU062180 1.0 mL

KRTAP17-1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-PRPF4 Antibody Picoband®, Dylight550 Conjugate
A08225-2-Dylight550 100 µg

Anti-PRPF4 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
STN 979-297X105-B7541 AC Signs
251653 Card of 1 Pictogram(s)

STN 979-297X105-B7541 AC Signs

Sign In for Pricing
View Details
C14orf80 (TEDC1) (NM_001134876) Human Tagged ORF Clone Lentiviral Particle
RC225602L3V 200 µL

C14orf80 (TEDC1) (NM_001134876) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tribio InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody
TBS10468-1 1 mg

Tribio InVivoMAb Anti-Mouse CD20 & CD3e Bispecific Antibody

Sign In for Pricing
View Details
SMARCE1P6 Protein Vector (Human) (pPM-C-HA)
44425021 500 ng

SMARCE1P6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details