Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc)

OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ox40-ligand-tnfsf4-protein-rabbit-hek293-hfc.html

Smiles

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Molecular Formula

100008595 (Gene_ID) O02765 (Q45-P187) (Accession)

Molecular Weight

44.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF405S conjugate, 0.1mg/mL
BNC042156-100 1x 100 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF488A conjugate, 0.1mg/mL
BNC882039-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2039), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF640R conjugate, 0.1mg/mL
BNC400667-100 1x 100 µL

CD1a (O10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details