OX40 Ligand/TNFSF4, Rabbit (HEK293, hFc)
OX40 Ligand/TNFSF4 Protein, a cytokine, binds TNFRSF4, acting as a potent T-cell co-stimulator for proliferation and cytokine production. As a homotrimer, its pivotal interaction with TNFRSF4 enhances immune response by activating and expanding T-cells. This engagement contributes to intricate regulation, making OX40 Ligand a key mediator in modulating T-cell functions for effective and controlled immune activation. OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc) is the recombinant Rabbit-derived OX40 Ligand/TNFSF4 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
OX40 Ligand/TNFSF4 Protein, Rabbit (HEK293, hFc), Rabbit, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ox40-ligand-tnfsf4-protein-rabbit-hek293-hfc.html
Smiles
QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Molecular Formula
100008595 (Gene_ID) O02765 (Q45-P187) (Accession)
Molecular Weight
44.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog