Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc)

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc) is a polypeptide chain with the C-terminal human IgG1 Fc fragment produced in HEK293 cells. CD28, a T cell costimulatory receptor, is a primary target for PD-1-mediated inhibition.

Product Specifications

Product Name Alternative

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293, hFc), Rhesus Macaque; Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd28-protein-human-cynomolgus-hek293-fc.html

Purity

98.0

Smiles

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Molecular Formula

940/102146670/705313 (Gene_ID) P10747-1/Q0PDN3/Q0PDN4 (N19-P152) (Accession)

Molecular Weight

66-70 kDa

References & Citations

[1]Hui E, et al. T cell costimulatory receptor CD28 is a primary target for PD-1-mediated inhibition. Science. 2017 Mar 31;355 (6332) :1428-1433.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL
BNC040257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MFGE8 (NM_005928) Human Over-expression Lysate
LY401796 100 µg

MFGE8 (NM_005928) Human Over-expression Lysate

Sign In for Pricing
View Details
PIK3R5 Antibody
8C17707-AAT 50 µg

PIK3R5 Antibody

Sign In for Pricing
View Details
Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL
BNC683167-500 1x 500 µL

Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAPK14 (CPTC-MAPK14-1), CF405S conjugate, 0.1mg/mL
BNC042228-100 1x 100 µL

MAPK14 (CPTC-MAPK14-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
tert-Butyl 4-Bromo-2-fluorobenzoate
TRC-B682025-250MG 250 mg

tert-Butyl 4-Bromo-2-fluorobenzoate

Sign In for Pricing
View Details