Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coagulation factor VIII (F8)

Product Specifications

Product Name Alternative

(Antihemophilic factor) (AHF) (Procoagulant component)

Abbreviation

Recombinant Human F8 protein

Gene Name

F8

UniProt

P00451

Expression Region

1-216aa

Organism

Homo sapiens (Human)

Target Sequence

MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Factor VIII, along with calcium and phospholipid, acts as a cofactor for F9/factor IXa when it converts F10/factor X to the activated form, factor Xa.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

56.2 kDa

References & Citations

"The acidic region of the factor VIII light chain and the C2 domain together form the high affinity binding site for von Willebrand factor." Saenko E.L., Scandella D. J. Biol. Chem. 272:18007-18014 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Juvenile Hormone B 3 (Mixture of Diastereomers), Technical Grade
TRC-J211205-2.5MG 2.5 mg

Juvenile Hormone B 3 (Mixture of Diastereomers), Technical Grade

Sign In for Pricing
View Details
POLD3 (C-term) Rabbit Polyclonal Antibody
AP53378PU-N 400 µL

POLD3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FTHL17 (NM_031894) Human Recombinant Protein
TP314888M 100 µg

FTHL17 (NM_031894) Human Recombinant Protein

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-01 50 μL

UHRF2 Antibody

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-02 100 µL

UHRF2 Antibody

Sign In for Pricing
View Details
UHRF2 Antibody
KC-2254-03 1 mL

UHRF2 Antibody

Sign In for Pricing
View Details