Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Peptidoglycan-associated lipoprotein (pal)

Product Specifications

Product Name Alternative

(PAL) (Outer membrane protein P6) (OMP P6) (P6-like)

Abbreviation

Recombinant Pasteurella multocida Peptidoglycan-associated lipoprotein

Gene Name

Pal

UniProt

Q51886

Expression Region

20-150aa

Organism

Pasteurella multocida (strain Pm70)

Target Sequence

CGSSKKDESAGQMFGGYSVQDLQQRYNTVYFGFDKYNIEGEYVQILDAHAAFLNATPATKVVVEGNTDERGTPEYNIALGQRRADAVKHYLSAKGVQAGQVSTVSYGEEKPAVLGHDEAAYSKNRRAVLAY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.3 kDa

References & Citations

"Pasteurella multocida produces a protein with homology to the P6 outer membrane protein of Haemophilus influenzae." Kasten R.W., Hansen L.M., Hinojoza J., Bieber D., Ruehl W.W., Hirsh D.C. Infect. Immun. 63:989-993 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAS Rabbit Monoclonal Antibody [Clone ID: R06-7A2]
TA385192 100 µL

RRAS Rabbit Monoclonal Antibody [Clone ID: R06-7A2]

Sign In for Pricing
View Details
ARID3B Human Gene Knockout Kit (CRISPR)
KN206328LP 1 Kit

ARID3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF405S conjugate, 0.1mg/mL
BNC040668-100 1x 100 µL

MART-1 / Melan-A (A103), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cathepsin S (CTSS) Human Gene Knockout Kit (CRISPR)
KN401215 1 Kit

Cathepsin S (CTSS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ADM (Adrenomedullin) CLIA Kit
E-CL-H0228-01 24 Tests

Human ADM (Adrenomedullin) CLIA Kit

Sign In for Pricing
View Details
Human ADM (Adrenomedullin) CLIA Kit
E-CL-H0228-02 48 Tests

Human ADM (Adrenomedullin) CLIA Kit

Sign In for Pricing
View Details