Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGMT, Human (His)

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MGMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mgmt-protein-human-his.html

Purity

98.0

Smiles

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Molecular Formula

4255 (Gene_ID) P16455 (M1-N207) (Accession)

Molecular Weight

Approximately 24.0-26.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Anti-Human VSIR/VISTA Antibody (CI-8993)
HP543026-01 100 µg

Research Grade Anti-Human VSIR/VISTA Antibody (CI-8993)

Sign In for Pricing
View Details
Research Grade Anti-Human VSIR/VISTA Antibody (CI-8993)
HP543026-02 1 mg

Research Grade Anti-Human VSIR/VISTA Antibody (CI-8993)

Sign In for Pricing
View Details
Fas, Recombinant, Fc, Human (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, CD95)
044783 50 µg

Fas, Recombinant, Fc, Human (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, CD95)

Sign In for Pricing
View Details
C1orf131 Recombinant Protein (Human)
RP004195 100 µg

C1orf131 Recombinant Protein (Human)

Sign In for Pricing
View Details
RND3 (NM_005168) Human Over-expression Lysate
LC417471 20 µg

RND3 (NM_005168) Human Over-expression Lysate

Sign In for Pricing
View Details
Rhox7 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6020103 1.0 µg DNA

Rhox7 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details