Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGMT, Human (His)

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MGMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mgmt-protein-human-his.html

Purity

98.0

Smiles

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Molecular Formula

4255 (Gene_ID) P16455 (M1-N207) (Accession)

Molecular Weight

Approximately 24.0-26.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-01 0.02 mg (E-Coli)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-02 0.1 mg (E-Coli)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-03 0.02 mg (Yeast)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-04 0.1 mg (Yeast)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-05 0.02 mg (Baculovirus)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. SsrA-binding protein (smpB)
MBS1214823-06 0.02 mg (Mammalian-Cell)

Recombinant Magnetococcus sp. SsrA-binding protein (smpB)

Sign In for Pricing
View Details