Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGMT, Human (His)

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MGMT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mgmt-protein-human-his.html

Purity

98.0

Smiles

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Molecular Formula

4255 (Gene_ID) P16455 (M1-N207) (Accession)

Molecular Weight

Approximately 24.0-26.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aspergillus flavus Xylanolytic transcriptional activator xlnR (xlnR), partial
MBS1019933 Inquire

Recombinant Aspergillus flavus Xylanolytic transcriptional activator xlnR (xlnR), partial

Sign In for Pricing
View Details
OTSC1 CRISPRa sgRNA lentivector (set of three targets)(Human)
35805121 3x 1.0µg DNA

OTSC1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Tmem150b 3'UTR Luciferase Stable Cell Line
TU222043 1.0 mL

Tmem150b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EIF4ENIF1 Human qPCR Primer Pair (NM_019843)
HP213460 200 Reactions

EIF4ENIF1 Human qPCR Primer Pair (NM_019843)

Sign In for Pricing
View Details
Cycleanin
TBZ2399 20mg

Cycleanin

Sign In for Pricing
View Details
RPL12P2 siRNA Oligos set (Human)
40771171 3x 5 nmol

RPL12P2 siRNA Oligos set (Human)

Sign In for Pricing
View Details