Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA2, Mouse (HEK293, His)

EphA2 protein is a receptor tyrosine kinase that promiscuously binds to ephrin A ligands to initiate bidirectional signaling. EphA2 is activated by ephrin-A1/EFNA1, regulates cell migration, adhesion, proliferation and differentiation, modulates DSG1 and inhibits ERK1/ERK2 signaling. EphA2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EphA2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha2-protein-mouse-hek293-his.html

Purity

95.00

Smiles

KEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDDMPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYGGEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLPSTEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQDIVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDANSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSAN

Molecular Formula

13836 (Gene_ID) Q03145 (K26-N535) (Accession)

Molecular Weight

Approximately 65-95 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin Type I Cytoskeletal 14 (KRT14) Mouse anti-Human Monoclonal (C-Terminus) (0.N.359) Antibody
GWB-BD615A 0.05 mL

Keratin Type I Cytoskeletal 14 (KRT14) Mouse anti-Human Monoclonal (C-Terminus) (0.N.359) Antibody

Sign In for Pricing
View Details
GMEB2 Protein Vector (Rat) (pPM-C-HA)
PV270536 500 ng

GMEB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
LY6E Protein Vector (Human) (pPB-C-His)
PV054893 500 ng

LY6E Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rat Prostaglandin Endoperoxide Synthase 1 (PTGS1) ELISA Kit
RD-PTGS1-Ra-01 96 Tests

Rat Prostaglandin Endoperoxide Synthase 1 (PTGS1) ELISA Kit

Sign In for Pricing
View Details
Rat Prostaglandin Endoperoxide Synthase 1 (PTGS1) ELISA Kit
RD-PTGS1-Ra-02 48 Tests

Rat Prostaglandin Endoperoxide Synthase 1 (PTGS1) ELISA Kit

Sign In for Pricing
View Details
ING2 Knockout Hela Polyclonal Cells
ARG26267 1 Million

ING2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details