Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wee1, Human (sf9, His)

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

Wee1 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wee1-protein-human-sf9-his.html

Purity

98.00

Smiles

MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

Molecular Formula

7465 (Gene_ID) P30291 (M291-K575) (Accession)

Molecular Weight

34.2 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein Recombinant Rabbit Monoclonal Antibody [SN06-42]
ET1611-30 100 µL

P Glycoprotein Recombinant Rabbit Monoclonal Antibody [SN06-42]

Sign In for Pricing
View Details
HYAL2 (Center) Rabbit Polyclonal Antibody
AP52133PU-N 400 µL

HYAL2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TTC9 Human Gene Knockout Kit (CRISPR)
KN420249 1 Kit

TTC9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Swsap1 Mouse Gene Knockout Kit (CRISPR)
KN517030 1 Kit

Swsap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MGEA5 Recombinant Rabbit Monoclonal Antibody [JG40-05]
ET7109-01 100 µL

MGEA5 Recombinant Rabbit Monoclonal Antibody [JG40-05]

Sign In for Pricing
View Details
DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody
HA751376 100 µL

DFNA5 / GSDME Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details