Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wee1, Human (sf9, His)

Wee1 Protein acts as a crucial negative regulator of the G2 to M transition, ensuring nuclear protection by phosphorylating CDK1 on 'Tyr-15' and inactivating the cyclin B1-CDK1 complex. Its peak activity in G2 phase decreases as cells progress into M phase, with dynamic regulation, increased phosphorylation during S and G2 phases, and diminished levels during M/G1 phase transition potentially due to degradation. Wee1 Protein, Human (sf9, His) is the recombinant human-derived Wee1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

Wee1 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wee1-protein-human-sf9-his.html

Purity

98.00

Smiles

MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRK

Molecular Formula

7465 (Gene_ID) P30291 (M291-K575) (Accession)

Molecular Weight

34.2 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
RDR-MLKL-Ra-01 96 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit
RDR-MLKL-Ra-02 48 Tests

Rat Mixed Lineage Kinase Domain Like Protein (MLKL) ELISA Kit

Sign In for Pricing
View Details
4-O-Beta-Galactopyranosyl-D-mannopyrase-octaacetate
TRC-G154860-1G 1 g

4-O-Beta-Galactopyranosyl-D-mannopyrase-octaacetate

Sign In for Pricing
View Details
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF405S conjugate, 0.1mg/mL
BNC041574-500 1x 500 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VE 821
TRC-V756700-100MG 100 mg

VE 821

Sign In for Pricing
View Details
DKK1 Antibody
KC-2424-01 50 μL

DKK1 Antibody

Sign In for Pricing
View Details