Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-37, Human

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-37 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-37-protein-human.html

Purity

97.04

Smiles

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Formula

27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lijuan Wang, et al. Interleukin-37: A crucial cytokine with multiple roles in disease and potentially clinical therapy. Oncol Lett. 2018 Apr;15 (4) :4711-4719.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF507 (NM_001136156) Human Over-expression Lysate
LC427829 20 µg

ZNF507 (NM_001136156) Human Over-expression Lysate

Sign In for Pricing
View Details
CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL
BNC942394-500 1x 500 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHPF (Center) Rabbit Polyclonal Antibody
AP50902PU-N 400 µL

CHPF (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]
AM50049PU-S 50 µL

Cathepsin S (CTSS) Mouse Monoclonal Antibody [Clone ID: AT1F9]

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF640R conjugate, 0.1mg/mL
BNC400499-100 1x 100 µL

Cytokeratin 14 (LL002), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sudan III
TRC-S688900-25G 25 g

Sudan III

Sign In for Pricing
View Details