Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-37, Human

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-37 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-37-protein-human.html

Purity

97.04

Smiles

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Formula

27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lijuan Wang, et al. Interleukin-37: A crucial cytokine with multiple roles in disease and potentially clinical therapy. Oncol Lett. 2018 Apr;15 (4) :4711-4719.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 9 (IL9) ELISA Kit
RD-IL9-Mu-01 96 Tests

Mouse Interleukin 9 (IL9) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 9 (IL9) ELISA Kit
RD-IL9-Mu-02 48 Tests

Mouse Interleukin 9 (IL9) ELISA Kit

Sign In for Pricing
View Details
4-Aminophenazone-d3
TRC-A621002-25MG 25 mg

4-Aminophenazone-d3

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/1931), Biotin conjugate, 0.1mg/mL
BNCB1931-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/1931), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LETMD1 Rabbit Polyclonal Antibody
TA364828 100 µL

LETMD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL
BNC941471-100 1x 100 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details