Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-37, Human

IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

IL-37 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-37-protein-human.html

Purity

97.04

Smiles

KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Molecular Formula

27178 (Gene_ID) Q9NZH6-1 (K53-D218) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Lijuan Wang, et al. Interleukin-37: A crucial cytokine with multiple roles in disease and potentially clinical therapy. Oncol Lett. 2018 Apr;15 (4) :4711-4719.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-01 0.1 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-02 0.2 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-03 0.5 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-04 1 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-05 5 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Osteopontin (OPN)
MBS2049370-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Osteopontin (OPN)

Sign In for Pricing
View Details