Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF-1 beta/CXCL12, Rat

SDF-1 beta (Stromal-derived factor-1β, SDF-1β) is a stromal derived CXC chemokine that signal through the CXCR4 receptor. SDF-1β has chemotactic activity on B and T cells[1][2]. SDF-1 beta/CXCL12 Protein, Rat is produced in E. coli.

Product Specifications

Product Name Alternative

SDF-1 beta/CXCL12 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cxcl12-sdf-1-beta-protein-rat.html

Purity

97.00

Smiles

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM

Molecular Formula

24772 (Gene_ID) NP_001029054.1 (K22-M93) (Accession)

Molecular Weight

Approximately 8.4 kDa

References & Citations

[1]Maria De La Luz Sierra, et al. Differential processing of stromal-derived factor-1alpha and stromal-derived factor-1beta explains functional diversity. Blood. 2004 Apr 1;103 (7) :2452-9.|[2]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[3]Miroslaw Janowski. Functional diversity of SDF-1 splicing variants. Cell Adh Migr. 2009 Jul-Sep;3 (3) :243-9.|[4]Kleanthis Fytianos, et al. Anti-Fibrotic Effect of SDF-1β Overexpression in Bleomycin-Injured Rat Lung. Pharmaceutics. 2022 Aug 27;14 (9) :1803.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EGF Like Domain Multiple 8 (EGFL8) Antibody
abx122807-01 100 µg

EGF Like Domain Multiple 8 (EGFL8) Antibody

Ask
View Details
EGF Like Domain Multiple 8 (EGFL8) Antibody
abx122807-02 1 mg

EGF Like Domain Multiple 8 (EGFL8) Antibody

Ask
View Details
Human Kisspeptin 54,KISS-54 ELISA KIT
JOT-EK3121Hu 96 wells

Human Kisspeptin 54,KISS-54 ELISA KIT

Ask
View Details
Myelin Basic Protein, Degraded (MBP) (Not for Export EU) discontinued. see M9758-04
M9758-01H 100 µL

Myelin Basic Protein, Degraded (MBP) (Not for Export EU) discontinued. see M9758-04

Ask
View Details