Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E-selectin/CD62E, Human (HEK293, His)

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-selectin/CD62E Protein, Human (HEK293, His) is the recombinant human-derived E-selectin/CD62E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

E-selectin/CD62E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/e-selectin-cd62e-protein-human-hek-293-his.html

Purity

98.0

Smiles

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Molecular Formula

6401 (Gene_ID) P16581 (W22-P556) (Accession)

Molecular Weight

Approximately 104 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIPEP Antibody
F40233-0.08ML 0.08 mL

MIPEP Antibody

Sign In for Pricing
View Details
GPR83 (NM_016540) Human Over-expression Lysate
LC402564 20 µg

GPR83 (NM_016540) Human Over-expression Lysate

Sign In for Pricing
View Details
GGA1 Rabbit Polyclonal Antibody
HA500534 100 µL

GGA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD16 (NM_001009943) Human Over-expression Lysate
LY423161 100 µg

ANKRD16 (NM_001009943) Human Over-expression Lysate

Sign In for Pricing
View Details
(2S)-4'-Depropyl-4'-propylidenelincomycin (Mixture of Diastereomers)
TRC-D281915-5MG 5 mg

(2S)-4'-Depropyl-4'-propylidenelincomycin (Mixture of Diastereomers)

Sign In for Pricing
View Details
FGFRL1 (N-term) Rabbit Polyclonal Antibody
AP51663PU-N 400 µL

FGFRL1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details