Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E-selectin/CD62E, Human (HEK293, His)

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-selectin/CD62E Protein, Human (HEK293, His) is the recombinant human-derived E-selectin/CD62E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

E-selectin/CD62E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/e-selectin-cd62e-protein-human-hek-293-his.html

Purity

98.0

Smiles

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Molecular Formula

6401 (Gene_ID) P16581 (W22-P556) (Accession)

Molecular Weight

Approximately 104 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM6 Human Gene Knockout Kit (CRISPR)
KN416965 1 Kit

TRPM6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3228), CF405S conjugate, 0.1mg/mL
BNC043228-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3228), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
OC-245-01 50 μL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
OC-245-02 100 µL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
OC-245-03 1 mL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35 + MSA/953), CF740 conjugate, 0.1mg/mL
BNC741013-500 1x 500 µL

Muscle Specific Actin (HHF35 + MSA/953), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details