Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E-selectin/CD62E, Human (HEK293, His)

E-selectin/CD62E Protein, a cell-surface glycoprotein, crucially mediates immunoadhesion by interacting with SELPLG/PSGL1 for the adhesion of neutrophils to cytokine-activated endothelium. It also potentially influences capillary morphogenesis and interacts with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, independently of SELPLG sulfation. E-selectin/CD62E Protein, Human (HEK293, His) is the recombinant human-derived E-selectin/CD62E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

E-selectin/CD62E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/e-selectin-cd62e-protein-human-hek-293-his.html

Purity

98.0

Smiles

WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Molecular Formula

6401 (Gene_ID) P16581 (W22-P556) (Accession)

Molecular Weight

Approximately 104 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 0.2mg/mL
BNUB2284-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), 0.2mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Pancreas
CS708540 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
SLC22A12 (NM_144585) Human Over-expression Lysate
LY403397 100 µg

SLC22A12 (NM_144585) Human Over-expression Lysate

Sign In for Pricing
View Details
SINHCAF (NM_021238) Human Over-expression Lysate
LY402857 100 µg

SINHCAF (NM_021238) Human Over-expression Lysate

Sign In for Pricing
View Details
MRPS24 (NM_032014) Human Over-expression Lysate
LY403136 100 µg

MRPS24 (NM_032014) Human Over-expression Lysate

Sign In for Pricing
View Details