Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 8 (FGF8), partial

Product Specifications

Product Name Alternative

FGF-8; Androgen-induced growth factor; AIGF; Heparin-binding growth factor 8; HBGF-8

Abbreviation

Recombinant Human FGF8 protein, partial

Gene Name

FGF8

UniProt

P55075

Expression Region

23-143aa

Organism

Homo sapiens (Human)

Target Sequence

QEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGK

Tag

N-terminal 6xHis-GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system (PubMed:16384934, PubMed:16597617, PubMed:8663044) . Plays a role in neurite outgrowth in hippocampal cells (PubMed:21576111) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.9 kDa

References & Citations

"Senataxin modulates neurite growth through fibroblast growth factor 8 signalling." Vantaggiato C., Bondioni S., Airoldi G., Bozzato A., Borsani G., Rugarli E.I., Bresolin N., Clementi E., Bassi M.T. Brain 134:1808-1828 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Channel-pan Antibody
8C0327-AAT 50 µg

Sodium Channel-pan Antibody

Sign In for Pricing
View Details
Uncoated Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-UNEL-H0282-01 5x 96 Tests

Uncoated Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-UNEL-H0282-02 15x 96 Tests

Uncoated Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Benzyl Nicotinate
TRC-B285465-5G 5 g

Benzyl Nicotinate

Sign In for Pricing
View Details
CEP70 Antibody
8C15047-AAT 50 µg

CEP70 Antibody

Sign In for Pricing
View Details
Synaptotagmin 1 (SYT1) Chicken Polyclonal Antibody
AP31821PU-N 400 µg

Synaptotagmin 1 (SYT1) Chicken Polyclonal Antibody

Sign In for Pricing
View Details