Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C/CST3, Human (HEK293)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Cystatin C/CST3 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-c-cst3-protein-human-hek-293.html

Purity

96.00

Smiles

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Molecular Formula

1471 (Gene_ID) P01034 (S27-A146) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-100 1x 100 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
BNC940304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details