Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C/CST3, Human (HEK293)

Cystatin C/CST3 protein can significantly inhibit cysteine proteases and locally regulate their enzymatic activity. It captures and binds free plasma hemoglobin, preventing kidney damage and supporting hepatic heme iron recycling. Cystatin C/CST3 Protein, Human (HEK293) is the recombinant human-derived Cystatin C/CST3 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Cystatin C/CST3 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-c-cst3-protein-human-hek-293.html

Purity

96.00

Smiles

SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Molecular Formula

1471 (Gene_ID) P01034 (S27-A146) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR1 (B-10) Alexa Fluor® 594
sc-393159 AF594 200 µg/mL

WDR1 (B-10) Alexa Fluor® 594

Sign In for Pricing
View Details
Plant Soluble Sugar Assay Kit (Colorimetric method)
G4324-48T 48 Tests

Plant Soluble Sugar Assay Kit (Colorimetric method)

Sign In for Pricing
View Details
Annexin A13 siRNA (h)
sc-60172 10 µM

Annexin A13 siRNA (h)

Sign In for Pricing
View Details
(3aS,4R,9bR) -4- (6-Bromo-1,3-benzodioxol-5-yl) -3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline
160879 2.5 mg

(3aS,4R,9bR) -4- (6-Bromo-1,3-benzodioxol-5-yl) -3a,4,5,9b-tetrahydro-3H-cyclopenta[c]quinoline

Sign In for Pricing
View Details
alpha TubµLin (TUBA4A) Human shRNA Lentiviral Particle (Locus ID 7277)
TL308572V 500 µL Each

alpha TubµLin (TUBA4A) Human shRNA Lentiviral Particle (Locus ID 7277)

Sign In for Pricing
View Details
Lentiviral mouse Slc13a3 shRNA (UAS) - Lentiviral mouseSlc13a3 shRNA (UAS, GFP) (25)
GTR15204716 1 Vial

Lentiviral mouse Slc13a3 shRNA (UAS) - Lentiviral mouseSlc13a3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details