Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG3, Human

ATG3 Protein, Human is a recombinant human Ubiquitin-like-conjugating Enzyme ATG3 expressed in E. coli. ATG3, the E2 ubiquitin-conjugating enzyme for the LC3 lipidation process, is essential for autophagy[1].

Product Specifications

Product Name Alternative

ATG3 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/atg3-protein-human.html

Purity

96.72

Smiles

MASMTGGQQMGMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTMHHHHHH

Molecular Formula

64422 (Gene_ID) Q9NT62 (M1-M314) (Accession)

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Naonobu Fujita, et al. The Atg16L complex specifies the site of LC3 lipidation for membrane biogenesis in autophagy. Mol Biol Cell. 2008 May;19 (5) :2092-100.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnpy2 (NM_019953) Mouse Tagged ORF Clone
MG201652 10 µg

Cnpy2 (NM_019953) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Microtube Adapter, 20 x 0.5ml for microplate shakers BT1500 and H6004)
BT1500-A05 1 Each

Microtube Adapter, 20 x 0.5ml for microplate shakers BT1500 and H6004)

Sign In for Pricing
View Details
CACNG1 Rabbit Polyclonal Antibody
ER1803-27 100 µL

CACNG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
beta-D-Glucosyl-N-hexadecanoylsphingosine
TRC-G711530-25MG 25 mg

beta-D-Glucosyl-N-hexadecanoylsphingosine

Sign In for Pricing
View Details
Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein
TP720491M 50 µg

Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS806063 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details