ATG3, Human
ATG3 Protein, Human is a recombinant human Ubiquitin-like-conjugating Enzyme ATG3 expressed in E. coli. ATG3, the E2 ubiquitin-conjugating enzyme for the LC3 lipidation process, is essential for autophagy[1].
Product Specifications
Product Name Alternative
ATG3 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/atg3-protein-human.html
Purity
96.72
Smiles
MASMTGGQQMGMQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTMHHHHHH
Molecular Formula
64422 (Gene_ID) Q9NT62 (M1-M314) (Accession)
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Naonobu Fujita, et al. The Atg16L complex specifies the site of LC3 lipidation for membrane biogenesis in autophagy. Mol Biol Cell. 2008 May;19 (5) :2092-100.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
24149064 1.0 µg DNA
ICAM4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
S9205-08A-ML405 100 µL
STX3, ID (Syntaxin-3, STX3A) (MaxLight 405) discontinued
Sign In for Pricing
View Details RC213816A1V 250 µL
Human HIST1H2AK (HIST1H2AI) (NM_003509) AAV Particle
Sign In for Pricing
View Details