Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Parvalbumin alpha (Pvalb)

Product Specifications

Abbreviation

Recombinant Mouse Pvalb protein

Gene Name

Pvalb

UniProt

P32848

Expression Region

2-110aa

Organism

Mus musculus (Mouse)

Target Sequence

SMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

"Electrospray ionization mass spectrometry: analysis of the Ca2+-binding properties of human recombinant alpha-parvalbumin and nine mutant proteins." Troxler H., Kuster T., Rhyner J.A., Gehrig P., Heizmann C.W. Anal. Biochem. 268:64-71 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL
BNC942385-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polyphenol Oxidase (PPO) Activity Assay Kit
E-BC-K259-S-01 50 Assays (25 samples)

Polyphenol Oxidase (PPO) Activity Assay Kit

Sign In for Pricing
View Details
Polyphenol Oxidase (PPO) Activity Assay Kit
E-BC-K259-S-02 100 Assays (50 samples)

Polyphenol Oxidase (PPO) Activity Assay Kit

Sign In for Pricing
View Details
Heparanase 1 (HPSE) Rabbit Polyclonal Antibody
AP08811PU-N 50 µg

Heparanase 1 (HPSE) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EAAC1 Antibody: HRP
SMC-406D-HRP 100 µg

EAAC1 Antibody: HRP

Sign In for Pricing
View Details
PTCD3 (NM_017952) Human Over-expression Lysate
LY402633 100 µg

PTCD3 (NM_017952) Human Over-expression Lysate

Sign In for Pricing
View Details